RBM39 antibody (Middle Region)
-
- Target See all RBM39 Antibodies
- RBM39 (RNA Binding Motif Protein 39 (RBM39))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBM39 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBM39 antibody was raised against the middle region of RBM39
- Purification
- Affinity purified
- Immunogen
- RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE
- Top Product
- Discover our top product RBM39 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBM39 Blocking Peptide, catalog no. 33R-3048, is also available for use as a blocking control in assays to test for specificity of this RBM39 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM39 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM39 (RNA Binding Motif Protein 39 (RBM39))
- Alternative Name
- RBM39 (RBM39 Products)
- Synonyms
- CAPER antibody, CAPERalpha antibody, FSAP59 antibody, HCC1 antibody, RNPC2 antibody, 1500012C14Rik antibody, 2310040E03Rik antibody, B330012G18Rik antibody, C79248 antibody, R75070 antibody, Rnpc2 antibody, caper antibody, RBM39 antibody, Rbm39 antibody, ACYPI002389 antibody, DKFZp459F148 antibody, rnpc2 antibody, zgc:55780 antibody, rnpc2l antibody, wu:fa97g07 antibody, wu:fb09c08 antibody, zgc:112139 antibody, zgc:113117 antibody, RNA binding motif protein 39 antibody, RNA binding motif protein 39a antibody, RNA binding motif protein 39 L homeolog antibody, RNA binding motif protein 39b antibody, RBM39 antibody, Rbm39 antibody, rbm39a antibody, rbm39.L antibody, rbm39b antibody
- Background
- RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors.
- Molecular Weight
- 20 kDa (MW of target protein)
-