PNPT1 antibody (Middle Region)

Catalog No. ABIN633243

The Rabbit Polyclonal anti-PNPT1 antibody (ABIN633243) specifically detects PNPT1 in WB. The antibody is reactive with Human samples.

Quick Overview for PNPT1 antibody (Middle Region) (ABIN633243)

Target: PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNPT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PNPT1 Antibody

Binding Specificity: Middle Region

Specificity: PNPT1 antibody was raised against the middle region of PNPT1

Purification: Affinity purified

Immunogen: PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNPT1 Blocking Peptide, (ABIN937084), is also available for use as a blocking control in assays to test for specificity of this PNPT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNPT1

Target: PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))

Alternative Name: PNPT1

Background: PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.

Molecular Weight: 86 kDa (MW of target protein)