SMN1 antibody (N-Term)

Catalog No. ABIN633245

The Rabbit Polyclonal anti-SMN1 antibody has been validated for WB. It is suitable to detect SMN1 in samples from Human and Dog.

Quick Overview for SMN1 antibody (N-Term) (ABIN633245)

Target: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SMN1 Antibody

Binding Specificity: N-Term

Specificity: SMN1 antibody was raised against the N terminal of SMN1

Purification: Affinity purified

Immunogen: SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMN1 Blocking Peptide, (ABIN939647), is also available for use as a blocking control in assays to test for specificity of this SMN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMN1

Target: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Alternative Name: SMN1

Background: SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization