SIP1 antibody (Middle Region)
-
- Target See all SIP1 (GEMIN2) Antibodies
- SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SIP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SIP1 antibody was raised against the middle region of SIP1
- Purification
- Affinity purified
- Immunogen
- SIP1 antibody was raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
- Top Product
- Discover our top product GEMIN2 Primary Antibody
-
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) antibody
GEMIN2 Reactivity: Human, Mouse, Rat IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (C-Term) antibodyGEMIN2 Reactivity: Human, Mouse, Rat WB, ELISA, IHC, ICC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 1-280) antibodyGEMIN2 Reactivity: Human WB, ELISA, IF, IP Host: Rabbit Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 1-280) antibodyGEMIN2 Reactivity: Human WB, IF Host: Mouse Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 12-280) antibodyGEMIN2 Reactivity: Human, Mouse, Xenopus laevis WB, ELISA, IF, IP, ICC, FACS Host: Mouse Monoclonal 2E17 unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 51-150) antibodyGEMIN2 Reactivity: Rat WB, ELISA, IF (p), IHC (p), IHC (fro), IF (cc) Host: Rabbit Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (Middle Region) antibodyGEMIN2 Reactivity: Human, Mouse, Rat, Horse, Cow, Dog, Rabbit, Pig WB Host: Rabbit Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (N-Term) antibodyGEMIN2 Reactivity: Human, Mouse, Rat WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (AA 35-84) antibodyGEMIN2 Reactivity: Human, Mouse, Rat, Horse, Cow, Dog, Rabbit, Pig, Guinea Pig, Monkey, Bat, Hamster WB Host: Rabbit Polyclonal unconjugated
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (C-Term) antibodyGEMIN2 Reactivity: Human, Horse, Cow, Dog, Pig, Monkey WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SIP1 Blocking Peptide, catalog no. 33R-3856, is also available for use as a blocking control in assays to test for specificity of this SIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))
- Alternative Name
- SIP1 (GEMIN2 Products)
- Synonyms
- SIP1 antibody, SIP1-delta antibody, 1700012N19Rik antibody, Sip1 antibody, sip1 antibody, sip1-delta antibody, wu:fc52a05 antibody, zgc:110274 antibody, gem nuclear organelle associated protein 2 antibody, gem (nuclear organelle) associated protein 2 antibody, gem nuclear organelle associated protein 2 S homeolog antibody, GEMIN2 antibody, Gemin2 antibody, gemin2.S antibody, gemin2 antibody
- Background
- Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
- Molecular Weight
- 30 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Tube Formation
-
