DDX58 antibody

Catalog No. ABIN633253

Product Details anti-DDX58 Antibody

Target: DDX58 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58 (DDX58))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX58 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DDX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX58 Blocking Peptide, catalog no. 33R-2340, is also available for use as a blocking control in assays to test for specificity of this DDX58 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX58

Target: DDX58 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58 (DDX58))

Alternative Name: DDX58 (DDX58 Products)

Synonyms: RIG-I antibody, RIGI antibody, RLR-1 antibody, 6430573D20Rik antibody, C330021E21 antibody, RHIV-1 antibody, RIG-1 antibody, DExD/H-box helicase 58 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 antibody, DEXD/H-box helicase 58 antibody, DDX58 antibody, Ddx58 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure.

Molecular Weight: 106 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Hepatitis C