INTS6 antibody (C-Term)

Catalog No. ABIN633264

This anti-INTS6 antibody is a Rabbit Polyclonal antibody detecting INTS6 in WB. Suitable for Human.

Quick Overview for INTS6 antibody (C-Term) (ABIN633264)

Target: INTS6 (Integrator Complex Subunit 6 (INTS6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INTS6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-INTS6 Antibody

Binding Specificity: C-Term

Specificity: INTS6 antibody was raised against the C terminal of INTS6

Purification: Affinity purified

Immunogen: INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INTS6 Blocking Peptide, (ABIN938647), is also available for use as a blocking control in assays to test for specificity of this INTS6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INTS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INTS6

Target: INTS6 (Integrator Complex Subunit 6 (INTS6))

Alternative Name: INTS6

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. INTS6 is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH).

Molecular Weight: 99 kDa (MW of target protein)