SNRPD1 antibody (N-Term)

Catalog No. ABIN633274

This Rabbit Polyclonal antibody specifically detects SNRPD1 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for SNRPD1 antibody (N-Term) (ABIN633274)

Target: SNRPD1 (Small Nuclear Ribonucleoprotein D1 Polypeptide 16kDa (SNRPD1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPD1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SNRPD1 Antibody

Binding Specificity: N-Term

Specificity: SNRPD1 antibody was raised against the N terminal of SNRPD1

Purification: Affinity purified

Immunogen: SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPD1 Blocking Peptide, (ABIN5616326), is also available for use as a blocking control in assays to test for specificity of this SNRPD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPD1

Target: SNRPD1 (Small Nuclear Ribonucleoprotein D1 Polypeptide 16kDa (SNRPD1))

Alternative Name: SNRPD1

Background: SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization