KRR1 antibody (C-Term)

Catalog No. ABIN633275

Product Details anti-KRR1 Antibody

Target: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KRR1 antibody was raised against the C terminal of KRR1

Purification: Affinity purified

Immunogen: KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KRR1 Blocking Peptide, catalog no. 33R-4253, is also available for use as a blocking control in assays to test for specificity of this KRR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRR1

Target: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Alternative Name: KRR1 (KRR1 Products)

Synonyms: hrb2 antibody, zgc:136398 antibody, HRB2 antibody, RIP-1 antibody, 2610511F02Rik antibody, AI255219 antibody, AI428520 antibody, D10Ertd773e antibody, Hrb2 antibody, KRR1, small subunit (SSU) processome component, homolog S homeolog antibody, KRR1, small subunit (SSU) processome component, homolog (yeast) antibody, KRR1, small subunit processome component homolog antibody, KRR1 small subunit processome component homolog antibody, krr1.S antibody, krr1 antibody, KRR1 antibody, LOC475405 antibody, Krr1 antibody

Background: KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.

Molecular Weight: 44 kDa (MW of target protein)