ADAT1 antibody (C-Term)
-
- Target See all ADAT1 Antibodies
- ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADAT1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ADAT1 antibody was raised against the C terminal of ADAT1
- Purification
- Affinity purified
- Immunogen
- ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV
- Top Product
- Discover our top product ADAT1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADAT1 Blocking Peptide, catalog no. 33R-4947, is also available for use as a blocking control in assays to test for specificity of this ADAT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))
- Alternative Name
- ADAT1 (ADAT1 Products)
- Background
- ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.
- Molecular Weight
- 55 kDa (MW of target protein)
-