DHX58 antibody

Catalog No. ABIN633307

This Rabbit Polyclonal antibody specifically detects DHX58 in WB. It exhibits reactivity toward Human.

Quick Overview for DHX58 antibody (ABIN633307)

Target: DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX58 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DHX58 Antibody

Purification: Affinity purified

Immunogen: DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX58 Blocking Peptide, (ABIN937020), is also available for use as a blocking control in assays to test for specificity of this DHX58 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX58

Target: DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))

Alternative Name: DHX58

Background: DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling.

Molecular Weight: 76 kDa (MW of target protein)