DHX58 antibody
-
- Target See all DHX58 Antibodies
- DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHX58 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM
- Top Product
- Discover our top product DHX58 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHX58 Blocking Peptide, catalog no. 33R-1634, is also available for use as a blocking control in assays to test for specificity of this DHX58 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX58 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))
- Alternative Name
- DHX58 (DHX58 Products)
- Background
- DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling.
- Molecular Weight
- 76 kDa (MW of target protein)
-