DDX59 antibody

Catalog No. ABIN633308

The Rabbit Polyclonal anti-DDX59 antibody is suitable to detect DDX59 in samples from Human. It has been validated for WB.

Quick Overview for DDX59 antibody (ABIN633308)

Target: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX59 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDX59 Antibody

Purification: Affinity purified

Immunogen: DDX59 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX59 Blocking Peptide, (ABIN5613171), is also available for use as a blocking control in assays to test for specificity of this DDX59 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX59

Target: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Alternative Name: DDX59

Background: The specific function of DDX59 is not yet known.

Molecular Weight: 69 kDa (MW of target protein)