MIF4GD antibody (N-Term)

Catalog No. ABIN633321

This anti-MIF4GD antibody is a Rabbit Polyclonal antibody detecting MIF4GD in WB. Suitable for Human.

Quick Overview for MIF4GD antibody (N-Term) (ABIN633321)

Target: MIF4GD (MIF4G Domain Containing (MIF4GD))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MIF4GD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MIF4GD Antibody

Binding Specificity: N-Term

Specificity: MIF4 GD antibody was raised against the N terminal of MIF4 D

Purification: Affinity purified

Immunogen: MIF4 GD antibody was raised using the N terminal of MIF4 D corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MIF4GD Blocking Peptide, (ABIN5614769), is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MIF4GD

Target: MIF4GD (MIF4G Domain Containing (MIF4GD))

Alternative Name: MIF4GD

Background: MIF4GD is a protein which contains an MIF4G domain.

Molecular Weight: 29 kDa (MW of target protein)