DHX37 antibody

Catalog No. ABIN633324

The Rabbit Polyclonal anti-DHX37 antibody (ABIN633324) specifically detects DHX37 in WB. The antibody is reactive with Human samples.

Quick Overview for DHX37 antibody (ABIN633324)

Target: DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX37 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DHX37 Antibody

Purification: Affinity purified

Immunogen: DHX37 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX37 Blocking Peptide, (ABIN5613198), is also available for use as a blocking control in assays to test for specificity of this DHX37 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX37

Target: DHX37 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37))

Alternative Name: DHX37

Background: DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molecular Weight: 129 kDa (MW of target protein)