PCBP3 antibody

Catalog No. ABIN633353

Product Details anti-PCBP3 Antibody

Target: PCBP3 (Poly(rC) Binding Protein 3 (PCBP3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCBP3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCBP3 Blocking Peptide, catalog no. 33R-7759, is also available for use as a blocking control in assays to test for specificity of this PCBP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCBP3

Target: PCBP3 (Poly(rC) Binding Protein 3 (PCBP3))

Alternative Name: PCBP3 (PCBP3 Products)

Synonyms: AlphaCP-3 antibody, ALPHA-CP3 antibody, alpha-CP3 antibody, zgc:109966 antibody, poly(rC) binding protein 3 antibody, Pcbp3 antibody, PCBP3 antibody, pcbp3 antibody

Background: This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions.

Molecular Weight: 36 kDa (MW of target protein)