A2BP1 antibody (Middle Region)

Catalog No. ABIN633356

Product Details anti-A2BP1 Antibody

Target: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This A2BP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: A2 BP1 antibody was raised against the middle region of A2 P1

Purification: Affinity purified

Immunogen: A2 BP1 antibody was raised using the middle region of A2 P1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

A2BP1 Blocking Peptide, catalog no. 33R-8963, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for A2BP1

Target: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Alternative Name: A2BP1 (A2BP1 Products)

Synonyms: A2BP1 antibody, fox1 antibody, a2bp1 antibody, zgc:103635 antibody, 2BP1 antibody, FOX-1 antibody, FOX1 antibody, HRNBP1 antibody, A2bp antibody, A2bp1 antibody, Hrnbp1 antibody, fox-1 antibody, RNA binding protein, fox-1 homolog 1 antibody, RNA binding fox-1 homolog 1 antibody, multicopper ferroxidase antibody, RNA binding protein, fox-1 homolog (C. elegans) 1 antibody, RBFOX1 antibody, rbfox1 antibody, FOX1 antibody, Rbfox1 antibody

Background: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2).

Molecular Weight: 42 kDa (MW of target protein)