DHX32 antibody

Catalog No. ABIN633369

Product Details anti-DHX32 Antibody

Target: DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX32 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX32 Blocking Peptide, catalog no. 33R-2347, is also available for use as a blocking control in assays to test for specificity of this DHX32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX32

Target: DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))

Alternative Name: DHX32 (DHX32 Products)

Synonyms: DDX32 antibody, DHLP1 antibody, 3110079L04Rik antibody, 4732469F02Rik antibody, AA408140 antibody, Ddx32 antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 32 antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 32b antibody, DEAH-box helicase 32 (putative) antibody, DEAH-box helicase 32 (putative) L homeolog antibody, DHX32 antibody, dhx32b antibody, Dhx32 antibody, dhx32.L antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.

Molecular Weight: 84 kDa (MW of target protein)