NOVA1 antibody (C-Term)

Catalog No. ABIN633405

This anti-NOVA1 antibody is a Rabbit Polyclonal antibody detecting NOVA1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for NOVA1 antibody (C-Term) (ABIN633405)

Target: NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOVA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NOVA1 Antibody

Binding Specificity: C-Term

Specificity: NOVA1 antibody was raised against the C terminal of NOVA1

Purification: Affinity purified

Immunogen: NOVA1 antibody was raised using the C terminal of NOVA1 corresponding to a region with amino acids SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOVA1 Blocking Peptide, catalog no. 33R-8555, is also available for use as a blocking control in assays to test for specificity of this NOVA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOVA1

Target: NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))

Alternative Name: NOVA1

Background: NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.

Molecular Weight: 52 kDa (MW of target protein)