SR140 antibody (N-Term)

Catalog No. ABIN633416

The Rabbit Polyclonal anti-SR140 antibody has been validated for WB. It is suitable to detect SR140 in samples from Human, Mouse and Rat.

Quick Overview for SR140 antibody (N-Term) (ABIN633416)

Target: SR140 (U2-Associated SR140 Protein (SR140))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SR140 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SR140 Antibody

Binding Specificity: N-Term

Specificity: SR140 antibody was raised against the N terminal of SR140

Purification: Affinity purified

Immunogen: SR140 antibody was raised using the N terminal of SR140 corresponding to a region with amino acids NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SR140 Blocking Peptide, (ABIN5616386), is also available for use as a blocking control in assays to test for specificity of this SR140 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SR140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SR140

Target: SR140 (U2-Associated SR140 Protein (SR140))

Alternative Name: SR140

Background: The specific function of SR140 is not yet known.

Molecular Weight: 118 kDa (MW of target protein)