CARS antibody (Middle Region)

Catalog No. ABIN633421

This Rabbit Polyclonal antibody specifically detects CARS in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for CARS antibody (Middle Region) (ABIN633421)

Target: CARS (Cysteinyl-tRNA Synthetase (CARS))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CARS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CARS Antibody

Binding Specificity: Middle Region

Specificity: CARS antibody was raised against the middle region of CARS

Purification: Affinity purified

Immunogen: CARS antibody was raised using the middle region of CARS corresponding to a region with amino acids QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CARS Blocking Peptide, (ABIN5612627), is also available for use as a blocking control in assays to test for specificity of this CARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CARS

Target: CARS (Cysteinyl-tRNA Synthetase (CARS))

Alternative Name: CARS

Background: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. CARS gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Molecular Weight: 95 kDa (MW of target protein)