RAD51AP1 antibody (Middle Region)

Catalog No. ABIN633433

This Rabbit Polyclonal antibody specifically detects RAD51AP1 in WB. It exhibits reactivity toward Human.

Quick Overview for RAD51AP1 antibody (Middle Region) (ABIN633433)

Target: RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD51AP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAD51AP1 Antibody

Binding Specificity: Middle Region

Specificity: RAD51 AP1 antibody was raised against the middle region of RAD51 P1

Purification: Affinity purified

Immunogen: RAD51 AP1 antibody was raised using the middle region of RAD51 P1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD51AP1 Blocking Peptide, (ABIN937694), is also available for use as a blocking control in assays to test for specificity of this RAD51AP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Concentration: Lot specific

Buffer: Supplied as cell culture supernatant.

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD51AP1

Target: RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))

Alternative Name: RAD51AP1

Background: RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.

Molecular Weight: 37 kDa (MW of target protein)