DAZ2 antibody (Deleted in Azoospermia 2) (N-Term)

Details for Product anti-DAZ2 Antibody No. ABIN633469
Antigen
Epitope
N-Term
10
10
8
6
2
1
1
1
1
1
Reactivity
Human
37
7
7
1
1
1
1
1
1
Host
Rabbit
37
Clonality
Polyclonal
Conjugate
This DAZ2 antibody is un-conjugated
4
4
2
2
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
36
16
4
3
3
2
1
1
Options
Immunogen DAZ2 antibody was raised using the N terminal of DAZ2 corresponding to a region with amino acids MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ
Specificity DAZ2 antibody was raised against the N terminal of DAZ2
Purification Affinity purified
Antigen
Alternative Name DAZ2 (DAZ2 Antibody Abstract)
Background DAZ2 is a member of the DAZ family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.
Molecular Weight 59 kDa (MW of target protein)
Application Notes WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

DAZ2 Blocking Peptide, catalog no. 33R-5830, is also available for use as a blocking control in assays to test for specificity of this DAZ2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Deleted in Azoospermia 2 (DAZ2) (N-Term) antibody (ABIN633469) DAZ2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Image no. 2 for anti-Deleted in Azoospermia 2 (DAZ2) (N-Term) antibody (ABIN633469) DAZ2 antibody used at 0.5 ug/ml to detect target protein.