PAIP1 antibody
-
- Target See all PAIP1 Antibodies
- PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAIP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS
- Top Product
- Discover our top product PAIP1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PAIP1 Blocking Peptide, catalog no. 33R-6406, is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))
- Alternative Name
- PAIP1 (PAIP1 Products)
- Background
- PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.
- Molecular Weight
- 46 kDa (MW of target protein)
-