PAIP1 antibody

Catalog No. ABIN633480

This anti-PAIP1 antibody is a Rabbit Polyclonal antibody detecting PAIP1 in WB. Suitable for Human and Mouse.

Quick Overview for PAIP1 antibody (ABIN633480)

Target: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAIP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAIP1 Antibody

Purification: Affinity purified

Immunogen: PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAIP1 Blocking Peptide, (ABIN5615194), is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAIP1

Target: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Alternative Name: PAIP1

Background: PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.

Molecular Weight: 46 kDa (MW of target protein)