STAU1/Staufen antibody

Catalog No. ABIN633486

The Rabbit Polyclonal anti-STAU1/Staufen antibody (ABIN633486) specifically detects STAU1/Staufen in WB. The antibody is reactive with Human samples.

Quick Overview for STAU1/Staufen antibody (ABIN633486)

Target: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAU1/Staufen antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STAU1/Staufen Antibody

Purification: Affinity purified

Immunogen: STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STAU1 Blocking Peptide, (ABIN5616432), is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STAU1/Staufen

Target: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Alternative Name: STAU1

Background: This protein is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: Asymmetric Protein Localization