RBM38 antibody (N-Term)

Catalog No. ABIN633487

Product Details anti-RBM38 Antibody

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM38 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: RBM38 antibody was raised against the N terminal of RBM38

Purification: Affinity purified

Immunogen: RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM38 Blocking Peptide, catalog no. 33R-5295, is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM38

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Alternative Name: RBM38 (RBM38 Products)

Synonyms: rnpc1 antibody, seb4b antibody, seb4d antibody, XSeb4R antibody, MGC89204 antibody, hsrnaseb antibody, YF-55 antibody, fi25e12 antibody, wu:fi25e12 antibody, zgc:92336 antibody, xseb4r antibody, HSRNASEB antibody, RNPC1 antibody, SEB4B antibody, SEB4D antibody, dJ800J21.2 antibody, Rnpc1 antibody, Seb4 antibody, Seb4l antibody, RNA binding motif protein 38 antibody, RNA binding motif protein 38 L homeolog antibody, rbm38 antibody, rbm38.L antibody, RBM38 antibody, Rbm38 antibody

Background: RBM38 is a probable RNA-binding protein.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development