RBM38 antibody (Middle Region)

Catalog No. ABIN633488

The Rabbit Polyclonal anti-RBM38 antibody has been validated for WB. It is suitable to detect RBM38 in samples from Human, Mouse and Rat.

Quick Overview for RBM38 antibody (Middle Region) (ABIN633488)

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM38 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBM38 Antibody

Binding Specificity: Middle Region

Specificity: RBM38 antibody was raised against the middle region of RBM38

Purification: Affinity purified

Immunogen: RBM38 antibody was raised using the middle region of RBM38 corresponding to a region with amino acids QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM38 Blocking Peptide, (ABIN5615791), is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM38

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Alternative Name: RBM38

Background: RBM38 is a probable RNA-binding protein.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development