CELF5 antibody (Middle Region)

Catalog No. ABIN633503

The Rabbit Polyclonal anti-CELF5 antibody has been validated for WB. It is suitable to detect CELF5 in samples from Human.

Quick Overview for CELF5 antibody (Middle Region) (ABIN633503)

Target: CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CELF5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CELF5 Antibody

Binding Specificity: Middle Region

Specificity: BRUNOL5 antibody was raised against the middle region of BRUNOL5

Purification: Affinity purified

Immunogen: BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids GVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BRUNOL5 Blocking Peptide, (ABIN939045), is also available for use as a blocking control in assays to test for specificity of this BRUNOL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CELF5

Target: CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))

Alternative Name: BRUNOL5

Background: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.

Molecular Weight: 52 kDa (MW of target protein)