C19orf24 antibody (N-Term)

Catalog No. ABIN633528

Product Details anti-C19orf24 Antibody

Target: C19orf24 (Chromosome 19 Open Reading Frame 24 (C19orf24))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C19orf24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C19 ORF24 antibody was raised against the N terminal Of C19 rf24

Purification: Affinity purified

Immunogen: C19 ORF24 antibody was raised using the N terminal Of C19 rf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF24 Blocking Peptide, catalog no. 33R-6357, is also available for use as a blocking control in assays to test for specificity of this C19ORF24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C19orf24

Target: C19orf24 (Chromosome 19 Open Reading Frame 24 (C19orf24))

Alternative Name: C19ORF24 (C19orf24 Products)

Synonyms: chromosome 19 open reading frame 24 antibody, C19orf24 antibody, c19orf24 antibody

Background: C19orf24 is a novel human non-classical secreted protein which is encoded by the hypothetical gene C19orf24 (chromosome 19 open reading frame 24). The exact function of C19orf24 remains unknown.

Molecular Weight: 14 kDa (MW of target protein)