IREB2 antibody (Middle Region)

Catalog No. ABIN633564

This anti-IREB2 antibody is a Rabbit Polyclonal antibody detecting IREB2 in WB. Suitable for Human.

Quick Overview for IREB2 antibody (Middle Region) (ABIN633564)

Target: IREB2 (Iron-Responsive Element Binding Protein 2 (IREB2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IREB2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IREB2 Antibody

Binding Specificity: Middle Region

Specificity: IREB2 antibody was raised against the middle region of IREB2

Purification: Affinity purified

Immunogen: IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IREB2 Blocking Peptide, catalog no. 33R-4113, is also available for use as a blocking control in assays to test for specificity of this IREB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IREB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IREB2

Target: IREB2 (Iron-Responsive Element Binding Protein 2 (IREB2))

Alternative Name: IREB2

Background: IREB2 binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. IREB2 binds to the IRE element in ferritin which results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.

Molecular Weight: 105 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis