IREB2 antibody (Middle Region)
-
- Target See all IREB2 Antibodies
- IREB2 (Iron-Responsive Element Binding Protein 2 (IREB2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IREB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IREB2 antibody was raised against the middle region of IREB2
- Purification
- Affinity purified
- Immunogen
- IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK
- Top Product
- Discover our top product IREB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IREB2 Blocking Peptide, catalog no. 33R-4113, is also available for use as a blocking control in assays to test for specificity of this IREB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IREB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IREB2 (Iron-Responsive Element Binding Protein 2 (IREB2))
- Alternative Name
- IREB2 (IREB2 Products)
- Background
- IREB2 binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. IREB2 binds to the IRE element in ferritin which results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.
- Molecular Weight
- 105 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-