Aconitase 1 antibody (N-Term)

Catalog No. ABIN633567

Product Details anti-Aconitase 1 Antibody

Target: Aconitase 1 (ACO1)

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aconitase 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ACO1 antibody was raised against the N terminal of ACO1

Purification: Affinity purified

Immunogen: ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 12 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACO1 Blocking Peptide, catalog no. 33R-6475, is also available for use as a blocking control in assays to test for specificity of this ACO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Aconitase 1

Target: Aconitase 1 (ACO1)

Alternative Name: ACO1 (ACO1 Products)

Synonyms: ACONS antibody, IREB1 antibody, IREBP antibody, IREBP1 antibody, IRP1 antibody, Acon1 antibody, Ratireb antibody, ratireb antibody, Aco1 antibody, AI256519 antibody, Aco-1 antibody, Irebp antibody, Irp1 antibody, aconitase 1 antibody, aconitase 1, soluble antibody, aconitase 1 L homeolog antibody, ACO1 antibody, Aco1 antibody, aco1.L antibody

Background: ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis