DHX34 antibody

Catalog No. ABIN633572

The Rabbit Polyclonal anti-DHX34 antibody has been validated for WB. It is suitable to detect DHX34 in samples from Human.

Quick Overview for DHX34 antibody (ABIN633572)

Target: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX34 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DHX34 Antibody

Purification: Affinity purified

Immunogen: DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX34 Blocking Peptide, (ABIN936820), is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX34

Target: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Alternative Name: DHX34

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.

Molecular Weight: 128 kDa (MW of target protein)