DHX34 antibody
-
- Target See all DHX34 Antibodies
- DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHX34 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH
- Top Product
- Discover our top product DHX34 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHX34 Blocking Peptide, catalog no. 33R-1434, is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))
- Alternative Name
- DHX34 (DHX34 Products)
- Synonyms
- DDX34 antibody, HRH1 antibody, 1200013B07Rik antibody, 1810012L18Rik antibody, Ddx34 antibody, mKIAA0134 antibody, DExH-box helicase 34 antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 34 antibody, DEAH-box helicase 34 antibody, DHX34 antibody, dhx34 antibody, Dhx34 antibody
- Background
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.
- Molecular Weight
- 128 kDa (MW of target protein)
-