STAU1/Staufen antibody

Catalog No. ABIN633583

This Rabbit Polyclonal antibody specifically detects STAU1/Staufen in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for STAU1/Staufen antibody (ABIN633583)

Target: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAU1/Staufen antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STAU1/Staufen Antibody

Purification: Affinity purified

Immunogen: STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STAU1 Blocking Peptide, (ABIN5616431), is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STAU1/Staufen

Target: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Alternative Name: STAU1

Background: STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Asymmetric Protein Localization