BAT1 antibody (N-Term)

Catalog No. ABIN633595

This Rabbit Polyclonal antibody specifically detects BAT1 in WB. It exhibits reactivity toward Human.

Quick Overview for BAT1 antibody (N-Term) (ABIN633595)

Target: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BAT1 Antibody

Binding Specificity: N-Term

Specificity: BAT1 antibody was raised against the N terminal of BAT1

Purification: Affinity purified

Immunogen: BAT1 antibody was raised using the N terminal of BAT1 corresponding to a region with amino acids MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BAT1 Blocking Peptide, (ABIN5612276), is also available for use as a blocking control in assays to test for specificity of this BAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BAT1

Target: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Alternative Name: BAT1

Background: BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization