SRGN antibody (Middle Region)

Catalog No. ABIN633597

This anti-SRGN antibody is a Rabbit Polyclonal antibody detecting SRGN in WB. Suitable for Human.

Quick Overview for SRGN antibody (Middle Region) (ABIN633597)

Target: SRGN (serglycin (SRGN))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRGN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SRGN Antibody

Binding Specificity: Middle Region

Specificity: Serglycin antibody was raised against the middle region of SRGN

Purification: Affinity purified

Immunogen: Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Serglycin Blocking Peptide, ABIN5616055, is also available for use as a blocking control in assays to test for specificity of this Serglycin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRGN

Target: SRGN (serglycin (SRGN))

Alternative Name: Serglycin

Background: SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Maintenance of Protein Location