SRGN antibody (Middle Region)
-
- Target See all SRGN Antibodies
- SRGN (serglycin (SRGN))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRGN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Serglycin antibody was raised against the middle region of SRGN
- Purification
- Affinity purified
- Immunogen
- Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY
- Top Product
- Discover our top product SRGN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Serglycin Blocking Peptide, catalog no. ABIN5616055, is also available for use as a blocking control in assays to test for specificity of this Serglycin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRGN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRGN (serglycin (SRGN))
- Alternative Name
- Serglycin (SRGN Products)
- Background
- SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.
- Molecular Weight
- 15 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location
-