AKAP1 antibody

Catalog No. ABIN633600

This anti-AKAP1 antibody is a Rabbit Polyclonal antibody detecting AKAP1 in WB. Suitable for Human.

Quick Overview for AKAP1 antibody (ABIN633600)

Target: AKAP1 (A Kinase (PRKA) Anchor Protein 1 (AKAP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AKAP1 Antibody

Purification: Affinity purified

Immunogen: AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKAP1 Blocking Peptide, (ABIN5611987), is also available for use as a blocking control in assays to test for specificity of this AKAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKAP1

Target: AKAP1 (A Kinase (PRKA) Anchor Protein 1 (AKAP1))

Alternative Name: AKAP1

Background: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Synaptic Membrane