KCTD7 antibody (N-Term)

Catalog No. ABIN633658

This Rabbit Polyclonal antibody specifically detects KCTD7 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for KCTD7 antibody (N-Term) (ABIN633658)

Target: KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCTD7 Antibody

Binding Specificity: N-Term

Specificity: KCTD7 antibody was raised against the N terminal of KCTD7

Purification: Affinity purified

Immunogen: KCTD7 antibody was raised using the N terminal of KCTD7 corresponding to a region with amino acids VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD7 Blocking Peptide, (ABIN5614311), is also available for use as a blocking control in assays to test for specificity of this KCTD7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD7

Target: KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))

Alternative Name: KCTD7

Background: The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels. KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain.

Molecular Weight: 33 kDa (MW of target protein)