KCNIP2 antibody (N-Term)

Catalog No. ABIN633671

Product Details anti-KCNIP2 Antibody

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNIP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KCNIP2 antibody was raised against the N terminal of KCNIP2

Purification: Affinity purified

Immunogen: KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS

Application Details

Application Notes: WB: 0.06 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNIP2 Blocking Peptide, catalog no. 33R-7647, is also available for use as a blocking control in assays to test for specificity of this KCNIP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNIP2

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Alternative Name: KCNIP2 (KCNIP2 Products)

Synonyms: KCHIP2 antibody, KCNIP2 antibody, Kchip2 antibody, KChIP2 antibody, kchip2 antibody, si:ch73-173h19.2 antibody, potassium voltage-gated channel interacting protein 2 antibody, Kv channel-interacting protein 2 antibody, Kv channel interacting protein 2 S homeolog antibody, Kv channel interacting protein 2 antibody, KCNIP2 antibody, Kcnip2 antibody, kcnip2.S antibody, kcnip2 antibody

Background: KCNIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.

Molecular Weight: 21 kDa (MW of target protein)