KCNV2 antibody (N-Term)

Catalog No. ABIN633692

The Rabbit Polyclonal anti-KCNV2 antibody is suitable to detect KCNV2 in samples from Human. It has been validated for WB.

Quick Overview for KCNV2 antibody (N-Term) (ABIN633692)

Target: KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNV2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCNV2 Antibody

Binding Specificity: N-Term

Specificity: KCNV2 antibody was raised against the N terminal of KCNV2

Purification: Affinity purified

Immunogen: KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNV2 Blocking Peptide, (ABIN5614300), is also available for use as a blocking control in assays to test for specificity of this KCNV2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNV2

Target: KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))

Alternative Name: KCNV2

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Molecular Weight: 62 kDa (MW of target protein)