KCNV2 antibody (N-Term)
-
- Target See all KCNV2 Antibodies
- KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNV2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNV2 antibody was raised against the N terminal of KCNV2
- Purification
- Affinity purified
- Immunogen
- KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK
- Top Product
- Discover our top product KCNV2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNV2 Blocking Peptide, catalog no. 33R-8183, is also available for use as a blocking control in assays to test for specificity of this KCNV2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))
- Alternative Name
- KCNV2 (KCNV2 Products)
- Background
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
- Molecular Weight
- 62 kDa (MW of target protein)
-