KCNC3 antibody (Middle Region)

Catalog No. ABIN633709

Product Details anti-KCNC3 Antibody

Target: KCNC3 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNC3 antibody was raised against the middle region of KCNC3

Purification: Affinity purified

Immunogen: KCNC3 antibody was raised using the middle region of KCNC3 corresponding to a region with amino acids YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNC3 Blocking Peptide, catalog no. 33R-10044, is also available for use as a blocking control in assays to test for specificity of this KCNC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNC3

Target: KCNC3 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3))

Alternative Name: KCNC3 (KCNC3 Products)

Synonyms: kcnc3-A antibody, Kv3.1 antibody, KShIIID antibody, Kcr2-3 antibody, Kv3.3 antibody, KSHIIID antibody, KV3.3 antibody, SCA13 antibody, kcnc1 antibody, kshiiid antibody, kv3.3 antibody, sca13 antibody, potassium voltage-gated channel subfamily C member 3 antibody, potassium channel, voltage gated Shaw related subfamily C, member 1 S homeolog antibody, potassium voltage gated channel, Shaw-related subfamily, member 3 antibody, potassium channel, voltage gated Shaw related subfamily C, member 3 L homeolog antibody, potassium voltage-gated channel, Shaw-related subfamily, member 3 antibody, KCNC3 antibody, kcnc1.S antibody, Kcnc3 antibody, kcnc3.L antibody

Background: The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. KCNC3 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Molecular Weight: 80 kDa (MW of target protein)