KCNK9 antibody (N-Term)

Catalog No. ABIN633772

Product Details anti-KCNK9 Antibody

Target: KCNK9 (Potassium Channel, Subfamily K, Member 9 (KCNK9))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNK9 antibody was raised against the N terminal of KCNK9

Purification: Affinity purified

Immunogen: KCNK9 antibody was raised using the N terminal of KCNK9 corresponding to a region with amino acids REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK9 Blocking Peptide, catalog no. 33R-7869, is also available for use as a blocking control in assays to test for specificity of this KCNK9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK9

Target: KCNK9 (Potassium Channel, Subfamily K, Member 9 (KCNK9))

Alternative Name: KCNK9 (KCNK9 Products)

Synonyms: Task3 antibody, K2p9.1 antibody, KT3.2 antibody, TASK-3 antibody, TASK3 antibody, KCNK9 antibody, LOC799704 antibody, Kcnk9 antibody, task3 antibody, k2p9.1 antibody, task-3 antibody, kt3.2 antibody, potassium channel, subfamily K, member 9 antibody, potassium two pore domain channel subfamily K member 9 antibody, potassium channel, two pore domain subfamily K, member 9 antibody, potassium channel, two pore domain subfamily K, member 9 L homeolog antibody, Kcnk9 antibody, KCNK9 antibody, kcnk9 antibody, kcnk9.L antibody

Background: KCNK9 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This open channel is highly expressed in the cerebellum. It is inhibited by extracellular acidification and arachidonic acid, and strongly inhibited by phorbol 12-myristate 13-acetate.

Molecular Weight: 42 kDa (MW of target protein)