ZACN antibody (N-Term)

Catalog No. ABIN633774

Product Details anti-ZACN Antibody

Target: ZACN (Zinc Activated Ligand-Gated Ion Channel (ZACN))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZACN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LGICZ1 antibody was raised against the N terminal Of Lgicz1

Purification: Affinity purified

Immunogen: LGICZ1 antibody was raised using the N terminal Of Lgicz1 corresponding to a region with amino acids PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LGICZ1 Blocking Peptide, catalog no. 33R-7358, is also available for use as a blocking control in assays to test for specificity of this LGICZ1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGICZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZACN

Target: ZACN (Zinc Activated Ligand-Gated Ion Channel (ZACN))

Alternative Name: LGICZ1 (ZACN Products)

Synonyms: LGICZ1 antibody, L2 antibody, LGICZ antibody, ZAC antibody, ZAC1 antibody, zinc activated ion channel antibody, ZACN antibody

Background: LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Synaptic Membrane