KCNK6 antibody (N-Term)

Catalog No. ABIN633776

Product Details anti-KCNK6 Antibody

Target: KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNK6 antibody was raised against the n terminal of KCNK6

Purification: Affinity purified

Immunogen: KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK6 Blocking Peptide, catalog no. 33R-8027, is also available for use as a blocking control in assays to test for specificity of this KCNK6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK6

Target: KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))

Alternative Name: KCNK6 (KCNK6 Products)

Synonyms: Twik2 antibody, Twik-2 antibody, im:7152114 antibody, zgc:110418 antibody, K2p6.1 antibody, KCNK8 antibody, TOSS antibody, TWIK-2 antibody, TWIK2 antibody, D7Ertd764e antibody, Toss antibody, potassium channel, two pore domain subfamily K, member 6 antibody, potassium two pore domain channel subfamily K member 6 antibody, potassium channel, subfamily K, member 6 antibody, potassium inwardly-rectifying channel, subfamily K, member 6 antibody, Kcnk6 antibody, KCNK6 antibody, kcnk6 antibody

Background: KCNK6 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.

Molecular Weight: 34 kDa (MW of target protein)