GABRQ antibody

Catalog No. ABIN633787

This Rabbit Polyclonal antibody specifically detects GABRQ in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GABRQ antibody (ABIN633787)

Target: GABRQ (gamma-aminobutyric Acid (GABA) Receptor, theta (GABRQ))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRQ antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GABRQ Antibody

Purification: Affinity purified

Immunogen: GABRQ antibody was raised using a synthetic peptide corresponding to a region with amino acids KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRQ Blocking Peptide, (ABIN939756), is also available for use as a blocking control in assays to test for specificity of this GABRQ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRQ

Target: GABRQ (gamma-aminobutyric Acid (GABA) Receptor, theta (GABRQ))

Alternative Name: GABRQ

Background: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor.

Molecular Weight: 72 kDa (MW of target protein)