HEY1 antibody (N-Term)

Catalog No. ABIN633815

The Rabbit Polyclonal anti-HEY1 antibody has been validated for WB. It is suitable to detect HEY1 in samples from Human, Mouse, Rat and Dog.

Quick Overview for HEY1 antibody (N-Term) (ABIN633815)

Target: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HEY1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HEY1 Antibody

Binding Specificity: N-Term

Specificity: HEY1 antibody was raised against the N terminal of HEY1

Purification: Affinity purified

Immunogen: HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HEY1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HEY1

Target: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Alternative Name: HEY1

Background: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Tube Formation