JARID2 antibody (N-Term)

Catalog No. ABIN633819

Product Details anti-JARID2 Antibody

Target: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JARID2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: JARID2 antibody was raised against the N terminal of JARID2

Purification: Affinity purified

Immunogen: JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

JARID2 Blocking Peptide, catalog no. 33R-9106, is also available for use as a blocking control in assays to test for specificity of this JARID2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JARID2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for JARID2

Target: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Alternative Name: JARID2 (JARID2 Products)

Synonyms: JMJ antibody, Jmj antibody, jumonji antibody, JARID2 antibody, jarid2 antibody, jmj antibody, si:dkey-211c3.1 antibody, Jumonji antibody, jarid2-a antibody, jarid2-b antibody, jarid2.S antibody, jarid2b antibody, jumonji and AT-rich interaction domain containing 2 antibody, jumonji, AT rich interactive domain 2 antibody, jumonji, AT rich interactive domain 2a antibody, jumonji, AT rich interactive domain 2b antibody, jumonji and AT-rich interaction domain containing 2 L homeolog antibody, JARID2 antibody, Jarid2 antibody, jarid2a antibody, jarid2 antibody, jarid2b antibody, jarid2.L antibody

Background: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation.

Molecular Weight: 139 kDa (MW of target protein)

Pathways: Chromatin Binding