APOE antibody (N-Term)

Catalog No. ABIN633837

This anti-APOE antibody is a Rabbit Polyclonal antibody detecting APOE in WB. Suitable for Human.

Quick Overview for APOE antibody (N-Term) (ABIN633837)

Target: APOE (Apolipoprotein E (APOE))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APOE Antibody

Binding Specificity: N-Term

Specificity: ApoE antibody was raised against the N terminal of APOE

Purification: Affinity purified

Immunogen: ApoE antibody was raised using the N terminal of APOE corresponding to a region with amino acids KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoE Blocking Peptide, (ABIN940102), is also available for use as a blocking control in assays to test for specificity of this ApoE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOE

Target: APOE (Apolipoprotein E (APOE))

Alternative Name: ApoE

Background: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Lipid Metabolism