SNCA antibody
-
- Target See all SNCA Antibodies
- SNCA (Synuclein, alpha (SNCA))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNCA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Synuclein Alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
- Top Product
- Discover our top product SNCA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Synuclein Alpha Blocking Peptide, catalog no. 33R-9853, is also available for use as a blocking control in assays to test for specificity of this Synuclein Alpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNCA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNCA (Synuclein, alpha (SNCA))
- Alternative Name
- Synuclein alpha (SNCA Products)
- Background
- Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.
- Molecular Weight
- 11 kDa (MW of target protein)
- Pathways
- Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling, Negative Regulation of Transporter Activity, Regulation of long-term Neuronal Synaptic Plasticity
-