OXCT1 antibody (Middle Region)

Catalog No. ABIN633896

The Rabbit Polyclonal anti-OXCT1 antibody is suitable to detect OXCT1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for OXCT1 antibody (Middle Region) (ABIN633896)

Target: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OXCT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OXCT1 Antibody

Binding Specificity: Middle Region

Specificity: OXCT1 antibody was raised against the middle region of OXCT1

Purification: Affinity purified

Immunogen: OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OXCT1 Blocking Peptide, (ABIN938828), is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OXCT1

Target: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Alternative Name: OXCT1

Background: CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis